SLC35A3, Polyclonal Antibody

Name SLC35A3, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS839116
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SLC35A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKET
Purity/Format Affinity purified
Description SLC35A3 antibody
Gene SLC35A3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.