| Name | SLC35B1, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS839957 |
| Prices | $370.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | SLC35B1 antibody was raised using the C terminal of SLC35B1 corresponding to a region with amino acids ALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGT |
| Purity/Format | Total IgG Protein A purified |
| Description | SLC35B1 antibody |
| Gene | SLC35B1 |
| Supplier Page | Shop |