Name | SLC35B1, Polyclonal Antibody |
---|---|
Supplier | MyBioSource |
Catalog | MBS839957 |
Prices | $370.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Dog |
Antigen | SLC35B1 antibody was raised using the C terminal of SLC35B1 corresponding to a region with amino acids ALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGT |
Purity/Format | Total IgG Protein A purified |
Description | SLC35B1 antibody |
Gene | SLC35B1 |
Supplier Page | Shop |