| Name | SLC35E2, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5301580 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SLC35E2 antibody was raised using the middle region of SLC35E2 corresponding to a region with amino acids AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP |
| Purity/Format | Affinity purified |
| Description | SLC35E2 antibody |
| Gene | SLC35E2B |
| Supplier Page | Shop |