| Name | SLC43A3, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5300257 |
| Prices | $370.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | SLC43A3 antibody was raised using the N terminal of SLC43A3 corresponding to a region with amino acids MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPD |
| Purity/Format | Total IgG Protein A purified |
| Description | SLC43A3 antibody |
| Gene | SLC43A3 |
| Supplier Page | Shop |