| Name | SLC44A3, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS839318 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SLC44A3 antibody was raised using the middle region of SLC44A3 corresponding to a region with amino acids TFAILIFFWVLWVAVLLSLGTAGAAQVMEGGQVEYKPLSGIRYMWSYHLI |
| Purity/Format | Affinity purified |
| Description | SLC44A3 antibody |
| Gene | SLC44A3 |
| Supplier Page | Shop |