| Name | SLC6A18, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5302715 |
| Prices | $370.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SLC6A18 antibody was raised using the middle region of SLC6A18 corresponding to a region with amino acids MHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAP |
| Purity/Format | Total IgG Protein A purified |
| Description | SLC6A18 antibody |
| Gene | SLC6A18 |
| Supplier Page | Shop |