Name | SLC7A14, Polyclonal Antibody |
---|---|
Supplier | MyBioSource |
Catalog | MBS839533 |
Prices | $370.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC |
Species Reactivities | Human, Mouse, Rat, Dog, Zebrafish |
Antigen | SLC7A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAFFIGWNLILEYLIGTAAGASALSSMFDSLANHTISRWMADSVGTLNGL |
Purity/Format | Total IgG Protein A purified |
Description | SLC7A14 antibody |
Gene | SLC7A14 |
Supplier Page | Shop |