SLC7A14, Polyclonal Antibody

Name SLC7A14, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS839533
Prices $370.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB IHC
Species Reactivities Human, Mouse, Rat, Dog, Zebrafish
Antigen SLC7A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAFFIGWNLILEYLIGTAAGASALSSMFDSLANHTISRWMADSVGTLNGL
Purity/Format Total IgG Protein A purified
Description SLC7A14 antibody
Gene SLC7A14
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.