| Name | SPAG11B, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5302112 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SPAG11B antibody was raised using the N terminal of SPAG11B corresponding to a region with amino acids MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNG |
| Purity/Format | Affinity purified |
| Description | SPAG11B antibody |
| Gene | SPAG11B |
| Supplier Page | Shop |