ST6GALNAC3, Polyclonal Antibody

Name ST6GALNAC3, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5302299
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen ST6GALNAC3 antibody was raised using the C terminal of ST6GALNAC3 corresponding to a region with amino acids HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHPNWT
Purity/Format Affinity purified
Description ST6GALNAC3 antibody
Gene ST6GALNAC3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.