STRA13, Polyclonal Antibody

Name STRA13, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5302550
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen STRA13 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVD
Purity/Format Affinity purified
Description STRA13 antibody
Gene STRA13
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.