| Name | SUNC1, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS839046 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SUNC1 antibody was raised using the C terminal of SUNC1 corresponding to a region with amino acids IKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL |
| Purity/Format | Affinity purified |
| Description | SUNC1 antibody |
| Gene | SUN3 |
| Supplier Page | Shop |