| Name | SUSD3, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5302728 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SUSD3 antibody was raised using the N terminal of SUSD3 corresponding to a region with amino acids LRLPPQATFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEW |
| Purity/Format | Affinity purified |
| Description | SUSD3 antibody |
| Gene | SUSD3 |
| Supplier Page | Shop |