TADA1L, Polyclonal Antibody

Name TADA1L, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5303499
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen TADA1L antibody was raised using a synthetic peptide corresponding to a region with amino acids REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC
Purity/Format Affinity purified
Description TADA1L antibody
Gene TADA1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.