Name | TADA1L, Polyclonal Antibody |
---|---|
Supplier | MyBioSource |
Catalog | MBS5303499 |
Prices | $455.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | TADA1L antibody was raised using a synthetic peptide corresponding to a region with amino acids REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC |
Purity/Format | Affinity purified |
Description | TADA1L antibody |
Gene | TADA1 |
Supplier Page | Shop |