Name | TBC1D24, Polyclonal Antibody |
---|---|
Supplier | MyBioSource |
Catalog | MBS5301361 |
Prices | $455.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | TBC1D24 antibody was raised using the middle region of TBC1D24 corresponding to a region with amino acids SDPADRLSPFLAARHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDGDL |
Purity/Format | Affinity purified |
Description | TBC1D24 antibody |
Gene | TBC1D24 |
Supplier Page | Shop |