TBC1D24, Polyclonal Antibody

Name TBC1D24, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5301361
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen TBC1D24 antibody was raised using the middle region of TBC1D24 corresponding to a region with amino acids SDPADRLSPFLAARHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDGDL
Purity/Format Affinity purified
Description TBC1D24 antibody
Gene TBC1D24
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.