| Name | TBC1D25, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS839937 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TBC1D25 antibody was raised using the N terminal of TBC1D25 corresponding to a region with amino acids KVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGG |
| Purity/Format | Affinity purified |
| Description | TBC1D25 antibody |
| Gene | TBC1D25 |
| Supplier Page | Shop |