| Name | Tetraspanin 10, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5300427 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Tetraspanin 10 antibody was raised using the N terminal of TSPAN10 corresponding to a region with amino acids SCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPADPMLG |
| Purity/Format | Affinity purified |
| Description | Tetraspanin 10 antibody |
| Gene | TSPAN10 |
| Supplier Page | Shop |