| Name | TIGD4, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5300896 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TIGD4 antibody was raised using the N terminal of TIGD4 corresponding to a region with amino acids RFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPMLRLKANDFAQK |
| Purity/Format | Affinity purified |
| Description | TIGD4 antibody |
| Gene | TIGD4 |
| Supplier Page | Shop |