| Name | TMC2, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS839021 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TMC2 antibody was raised using the middle region of TMC2 corresponding to a region with amino acids YCWCWDLEAGFPSYAEFDISGNVLGLIFNQGMIWMGSFYAPGLVGINVLR |
| Purity/Format | Affinity purified |
| Description | TMC2 antibody |
| Gene | TMC2 |
| Supplier Page | Shop |