| Name | TMCC2, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5303174 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | TMCC2 antibody was raised using the N terminal of TMCC2 corresponding to a region with amino acids GETTGANSAGGPTSDAGAAAAPNPGPRSKPPDLKKIQQLSEGSMFGHGLK |
| Purity/Format | Affinity purified |
| Description | TMCC2 antibody |
| Gene | TMCC2 |
| Supplier Page | Shop |