| Name | TMEM104, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5300122 |
| Prices | $370.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TMEM104 antibody was raised using the middle region of TMEM104 corresponding to a region with amino acids GDLAIYAAAVPFSLMQVTCSATGNDSCGVEADTKYNDTDRCWGPLRRVDA |
| Purity/Format | Total IgG Protein A purified |
| Description | TMEM104 antibody |
| Gene | TMEM104 |
| Supplier Page | Shop |