| Name | TMEM63A, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS839997 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TMEM63A antibody was raised using the N terminal of TMEM63A corresponding to a region with amino acids MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP |
| Purity/Format | Affinity purified |
| Description | TMEM63A antibody |
| Gene | TMEM63A |
| Supplier Page | Shop |