| Name | TMEM69, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5303135 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | TMEM69 antibody was raised using the middle region of TMEM69 corresponding to a region with amino acids AYGASFLSFLGGIRWGFALPEGSPAKPDYLNLASSAAPLFFSWFAFLISE |
| Purity/Format | Affinity purified |
| Description | TMEM69 antibody |
| Gene | TMEM69 |
| Supplier Page | Shop |