TMEM75, Polyclonal Antibody

Name TMEM75, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS839106
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen TMEM75 antibody was raised using the C terminal of TMEM75 corresponding to a region with amino acids VTISQDSETLSLDCDHRLFFSLPFTDPASGGQSQHSWPCPERSKNLPQVS
Purity/Format Affinity purified
Description TMEM75 antibody
Gene TMEM75
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.