| Name | TMEM9, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5301740 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TMEM9 antibody was raised using the C terminal of TMEM9 corresponding to a region with amino acids DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS |
| Purity/Format | Affinity purified |
| Description | TMEM9 antibody |
| Gene | TMEM9 |
| Supplier Page | Shop |