TMEM93, Polyclonal Antibody

Name TMEM93, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5300009
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen TMEM93 antibody was raised using the N terminal of TMEM93 corresponding to a region with amino acids AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG
Purity/Format Affinity purified
Description TMEM93 antibody
Gene EMC6
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.