Name | TMEM93, Polyclonal Antibody |
---|---|
Supplier | MyBioSource |
Catalog | MBS5300009 |
Prices | $455.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | TMEM93 antibody was raised using the N terminal of TMEM93 corresponding to a region with amino acids AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG |
Purity/Format | Affinity purified |
Description | TMEM93 antibody |
Gene | EMC6 |
Supplier Page | Shop |