| Name | TRAPPC6B, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5301492 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TRAPPC6B antibody was raised using the middle region of TRAPPC6B corresponding to a region with amino acids TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF |
| Purity/Format | Affinity purified |
| Description | TRAPPC6B antibody |
| Gene | TRAPPC6B |
| Supplier Page | Shop |