TRIML2, Polyclonal Antibody

Name TRIML2, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5303224
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen TRIML2 antibody was raised using the middle region of TRIML2 corresponding to a region with amino acids SEDLRTMRLRHGQQDGAGNPERLDFSAMVLAAESFTSGRHYWEVDVEKAT
Purity/Format Affinity purified
Description TRIML2 antibody
Gene TRIML2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.