| Name | TXNDC16, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5300488 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | TXNDC16 antibody was raised using the N terminal of TXNDC16 corresponding to a region with amino acids EVAEDPQQVSTVHLQLGLPLVFIVSQQATYEADRRTAEWVAWRLLGKAGV |
| Purity/Format | Affinity purified |
| Description | TXNDC16 antibody |
| Gene | TXNDC16 |
| Supplier Page | Shop |