| Name | WDR53, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5301331 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | WDR53 antibody was raised using the middle region of WDR53 corresponding to a region with amino acids NLLASADDSGAIKILDLENKKVIRSLKRHSNICSSVAFRPQRPQSLVSCG |
| Purity/Format | Affinity purified |
| Description | WDR53 antibody |
| Gene | WDR53 |
| Supplier Page | Shop |