| Name | YIPF6, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5302336 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | YIPF6 antibody was raised using the C terminal of YIPF6 corresponding to a region with amino acids MVRLFVVIVMFAWSIVASTALLADSQPPNRRALAVYPVFLFYFVISWMIL |
| Purity/Format | Affinity purified |
| Description | YIPF6 antibody |
| Gene | YIPF6 |
| Supplier Page | Shop |