EIF3C Antibody
| Name | EIF3C Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-46784 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: NELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKGTTE |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | EIF3CL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: EIF3C Antibody [NBP2-46784] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10, Lane 2: Human cell line RT-4, Lane 3: Human cell line U-251 MG](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26805_EIF3C-Antibody-Western-Blot-NBP2-46784-img0003.jpg)
![Immunohistochemistry: EIF3C Antibody [NBP2-46784] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26806_EIF3C-Antibody-Immunohistochemistry-NBP2-46784-img0001.jpg)