FLJ13946 Antibody
| Name | FLJ13946 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-46805 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: LSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGFDVRSVGNTLVLHQTALVEA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FLJ13946 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TTC30B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: TTC30B Antibody [NBP2-46805] - Staining of human cell line SH-SY5Y shows localization to nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8069_TTC30B-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-46805-img0002.jpg)
![Immunohistochemistry: TTC30B Antibody [NBP2-46805] - Staining of human fallopian tube shows distinct positivity in cilia.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8070_TTC30B-Antibody-Immunohistochemistry-NBP2-46805-img0001.jpg)