EIF3C Antibody
| Name | EIF3C Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-46741 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: YYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHS |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | EIF3CL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: EIF3C Antibody [NBP2-46741] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/4127_EIF3C-Antibody-Immunohistochemistry-NBP2-46741-img0001.jpg)
Immunohistochemistry: EIF3C Antibody [NBP2-46741] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.