CT45A1 Antibody

Name CT45A1 Antibody
Supplier Novus Biologicals
Catalog NBP2-46736
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: PGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADI
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CT45A1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.