C2orf27B Antibody
| Name | C2orf27B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-46706 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: QDQPSEELPDFMAPPVEPPASALELKVWLELEVAERGGQHSSSQQLPHCSQSWAQWKLWRQRPGFAIWAPLPHWRGTSLIQQ |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | C2orf27A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: C2orf27B Antibody [NBP2-46706] - Staining of human liver cancer tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11779_C2orf27B-Antibody-Immunohistochemistry-NBP2-46706-img0004.jpg)
Immunohistochemistry: C2orf27B Antibody [NBP2-46706] - Staining of human liver cancer tissue.
![Immunohistochemistry: C2orf27B Antibody [NBP2-46706] - Staining of human liver shows distinct cytoplasmic and membranous positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11780_C2orf27B-Antibody-Immunohistochemistry-NBP2-46706-img0001.jpg)
Immunohistochemistry: C2orf27B Antibody [NBP2-46706] - Staining of human liver shows distinct cytoplasmic and membranous positivity in hepatocytes.
![Immunohistochemistry: C2orf27B Antibody [NBP2-46706] - Staining of human liver shows distinct cytoplasmic and membranous positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11781_C2orf27B-Antibody-Immunohistochemistry-NBP2-46706-img0002.jpg)
Immunohistochemistry: C2orf27B Antibody [NBP2-46706] - Staining of human liver shows distinct cytoplasmic and membranous positivity in hepatocytes.