SPACA5B Antibody
| Name | SPACA5B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-46703 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: AGLNGYKGYGVGDWLCMAHYESGFDTAFVDHNPDGSSEYGIFQLNSAWWCDNGITPTKNLC |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SPACA5B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SPACA5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: SPACA5 Antibody [NBP2-46703] - Staining of human testis shows cytoplasmic positivity in acrosomal cap of sperm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/4100_SPACA5-Antibody-Immunohistochemistry-NBP2-46703-img0001.jpg)
Immunohistochemistry: SPACA5 Antibody [NBP2-46703] - Staining of human testis shows cytoplasmic positivity in acrosomal cap of sperm.