| Name | GSTA1/A2/A3/A4/A5 |
|---|---|
| Supplier | Nordic BioSite |
| Catalog | ABB-2012 |
| Clone | polyclonal |
| Applications | WB |
| Species Reactivities | Rat, Mouse |
| Antigen | A synthetic peptide corresponding to a sequence at the N-terminus of human GSTA1/A2/A3/A4/A5 (63-97aa MKLVQTRAILNYIASKYNLYGKDIKERALIDM YIE), different from the related mouse and rat sequences by five amino acids. |
| Purity/Format | Immunogen affinity purified. |
| Gene | Chst2 |
| Supplier Page | Shop |