ABHD10 antibody
| Name | ABHD10 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330680 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rabbit |
| Antigen | The immunogen for Anti-ABHD10 antibody is: synthetic peptide directed towards the middle region of Human ABHD10. Synthetic peptide located within the following region: CIRFDYSGVGSSDGNSEESTLGKWRKDVLSIIDDLADGPQILVGSSLGGW. |
| Description | Rabbit Polyclonal |
| Gene | ABHD10 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: ABHD10; Sample Tissue: THP-1 Whole Cell lysates; Antibody Dilution: 1.0ug/ml