ACAM / ASAM antibody
| Name | ACAM / ASAM antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA338676 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep |
| Antigen | The immunogen for Anti-Clmp antibody is: synthetic peptide directed towards the N-terminal region of Rat Clmp. Synthetic peptide located within the following region: LWLVTYYVGTLGTHTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDN. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | Clmp |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: Clmp; Sample Tissue: Rat Stomach lysates; Antibody Dilution: 1.0 ug/ml