ACOT6 antibody
| Name | ACOT6 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332243 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Horse, Human, Pig, Rat |
| Antigen | The immunogen for Anti-ACOT6 Antibody is: synthetic peptide directed towards the C-terminal region of Human ACOT6. Synthetic peptide located within the following region: ASVHAVLGEAIFYGGEPKAHSKAQVDAWQQIQTFFHKHLNGKKSVKHSKI. |
| Description | Rabbit Polyclonal |
| Gene | ACOT6 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: ACOT6; Sample Tissue: Fetal Lung lysates; Antibody Dilution: 1.0ug/ml