ACOXL antibody
| Name | ACOXL antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332182 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for Anti-ACOXL Antibody is: synthetic peptide directed towards the C-terminal region of Human ACOXL. Synthetic peptide located within the following region: SRRQFGPKTKEEVKIIEHQTQTLRLMPHLATALALTFVSRYAGALLDEDV. |
| Description | Rabbit Polyclonal |
| Gene | ACOXL |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: ACOXL; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0ug/ml