ACSL4 antibody
| Name | ACSL4 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA338631 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for Anti-Acsl4 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Acsl4. Synthetic peptide located within the following region: KLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELKNHYLKDIERMYGG. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | Acsl4 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: Acsl4; Sample Tissue: Mouse Thymus lysates; Antibody Dilution: 1.0 ug/ml