Name | AKNA / KIAA1968 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA337962 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Bovine, Guinea Pig, Human, Pig |
Antigen | The immunogen for anti-AKNA antibody is: synthetic peptide directed towards the C-terminal region of Human AKNA. Synthetic peptide located within the following region: SSTPSPKQRSKQAGSSPRPPPGLWYLATAPPAPAPPAFAYISSVPIMPYP. |
Purity/Format | Affinity Purified |
Description | Rabbit Polyclonal |
Gene | AKNA |
Supplier Page | Shop |