ALS2CR12 antibody
| Name | ALS2CR12 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA340323 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-ALS2CR12 antibody: synthetic peptide directed towards the N terminal of human ALS2CR12. Synthetic peptide located within the following region: SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQEETNKSFYEVINVSP. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | ALS2CR12 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-ALS2CR12 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: MCF7 cell lysate