ANKRD55 antibody
| Name | ANKRD55 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330744 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Human, Pig, Rabbit |
| Antigen | The immunogen for Anti-ANKRD55 antibody is: synthetic peptide directed towards the C-terminal region of Human ANKRD55. Synthetic peptide located within the following region: LSQESRTEPTRPPPSQSSRPQKKERRFNVLNQIFCKNKKEEQRAHQKDPS. |
| Description | Rabbit Polyclonal |
| Gene | ANKRD55 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: ANKRD55; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0ug/ml