ANUBL1 antibody
| Name | ANUBL1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333455 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | The immunogen for Anti-ZFAND4 Antibody is: synthetic peptide directed towards the N-terminal region of Human ZFAND4. Synthetic peptide located within the following region: EKTSCSKQVTFLVYQEGDQLNFFPAVDRGDGTLTPLSDSSKKIDFHLHVL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | ZFAND4 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: ZFAND4; Sample Tissue: HT1080 whole cell lysates; Antibody Dilution: 1.0 ug/ml.