AP1 complex subunit sigma-1A / AP1S1 antibody
| Name | AP1 complex subunit sigma-1A / AP1S1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331243 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Goat, Human, Mouse, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for Anti-Ap1s1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ap1s1. Synthetic peptide located within the following region: VCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDES. |
| Description | Rabbit Polyclonal |
| Gene | Ap1s1 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: Ap1s1; Sample Tissue: Mouse Heart lysates; Antibody Dilution: 1.0ug/ml