AP1GBP1 / SYNG antibody

Name AP1GBP1 / SYNG antibody
Supplier Acris Antibodies
Catalog TA331234
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Antigen The immunogen for Anti-SYNRG antibody is: synthetic peptide directed towards the N-terminal region of Human SYNRG. Synthetic peptide located within the following region: QQKLLEEERKRRQFEEQKQKLRLLSSVKPKTGEKSRDDALEAIKGNLDGF.
Description Rabbit Polyclonal
Gene SYNRG
Supplier Page Shop

Product images