AP4S1 antibody

Name AP4S1 antibody
Supplier Acris Antibodies
Catalog TA340151
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Antigen The immunogen for Anti-Ap4s1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Ap4s1. Synthetic peptide located within the following region: VSKSCLSRSSEQCSFIEYKDFKLIYRQYAALFVVVGVNDTENEMAIYEFI.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene AP4S1
Supplier Page Shop

Product images