APOPT1 antibody

Name APOPT1 antibody
Supplier Acris Antibodies
Catalog TA333613
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Horse, Human
Antigen The immunogen for Anti-APOPT1 Antibody is: synthetic peptide directed towards the C-terminal region of Human APOPT1. Synthetic peptide located within the following region: KEFLSKNFQKHMYYNRDWYKRNFAITFFMGKVALERIWNKLKQKQKKRSN.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene APOPT1
Supplier Page Shop

Product images